PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00115879001
Common NameGSBRNA2T00115879001, LOC106445403
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 327aa    MW: 36745.2 Da    PI: 5.5179
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00115879001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.5e-32160214155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWtpeLHe+Fveav++LGG ++A Pk++l++mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00115879001 160 KGRMRWTPELHEAFVEAVNHLGGMNNAKPKAVLKHMKVQGLTIYHVKSHLQKYRT 214
                          56****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.134157217IPR017930Myb domain
SuperFamilySSF466891.61E-17159214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-29159215IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-23160214IPR006447Myb domain, plants
PfamPF002491.3E-10162213IPR001005SANT/Myb domain
PfamPF143791.6E-21246290IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
METRNLAHTC SSIPPPDIPI NSQQHNQLIA GPYHHLLSAN GEAVGHIYSN DFPNAASSMV  60
SHEMLDWDDH ADLLDLGVVE EDDELITNEN PIMSPFWNDV FLVASSTSAP KVHESTMQSQ  120
IQQPQVPLQH PSPCVELPPL VRTVSSNSND NTNSTSAAAK GRMRWTPELH EAFVEAVNHL  180
GGMNNAKPKA VLKHMKVQGL TIYHVKSHLQ KYRTARYVSE PSEGSQETKL TPLEHVTSLD  240
TKRGIDINEA LRIQMEVQKQ LHEQLEVQRK MQLRIEEQGK VLLMMFEKQN MDFCKPEQED  300
KASEKTPESC SEEADSPRPK RPRNDE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.243480.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00115879001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013742412.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
RefseqXP_013608869.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_013608868.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078EMU70.0A0A078EMU7_BRANA; BnaC09g10430D protein
TrEMBLA0A0D3E3M90.0A0A0D3E3M9_BRAOL; Uncharacterized protein
STRINGBra036679.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20400.12e-94G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]